Human AGTRAP monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_065083 |
| Gene Id | 57085 |
| Gene Symbols | AGTRAP |
| Protein Name / Synonyms | ATRAP, MGC29646 |
| Clonality | Monoclonal |
| Immunogen Sequence | HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFA VPEGRSQDARGS |
| Isotype | Kappa, IgG1 |
| Recommended Applications | IHC, Western Blotting, ELISA |
| Research Area | Ras/Rap Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (31.46 KDa). |
![]() | Western blot analysis of AGTRAP over-expressed 293 cell line, cotransfected with AGTRAP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AGTRAP monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | AGTRAP monoclonal antibody Western Blot analysis of AGTRAP expression in Hela NE . |
![]() | Western Blot analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody. Lane 1: AGTRAP transfected lysate(16.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.8 ug/ml] |
![]() | Detection limit for recombinant GST tagged AGTRAP is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.
Anti-AGTRAP Antibody
Anti-AGTRAP Antibody