Human RNPC2 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse |
| Host Species | Mouse |
| Accession Number | NP_909122 |
| Gene Id | 9584 |
| Gene Symbols | RNPC2, RBM39 |
| Protein Name / Synonyms | CAPER, CAPERalpha, CC1.3, DKFZp781C0423, FLJ44170, HCC1, RNPC2, fSAP59 |
| Clonality | Monoclonal |
| Immunogen Sequence | TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIH IYVDKNSAQG |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (31.24 KDa). |
![]() | RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in NIH/3T3 . |
![]() | RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in Hela NE . |
![]() | Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody. Lane 1: RBM39 transfected lysate(58.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40 ug/ml] |
![]() | Detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.
Anti-RNPC2 Antibody
Anti-RNPC2 Antibody