Mouse Anti-Human ZNF202

Human ZNF202 monoclonal antibody (100 ug)

$412.00  
101-11977
+

Antigen Information

Accession Number:
  • NP_003446
Gene ID:
  • 7753
Gene Symbols:
  • ZNF202
Protein Name & Synonyms:
ZNF202
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB, IHC
Host Species:
Mouse
Immunogen Sequence:
QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHR PVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSF VNLRETTPVHPLLGRHHDCS
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

ZKSCAN10

Description

Mouse monoclonal antibody raised against a partial recombinant ZNF202.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_003455

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Immunoperoxidase of monoclonal antibody to ZNF202 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
Detection limit for recombinant GST tagged ZNF202 is approximately 0.1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.