CTLA4 Epitope Mapping Peptide Array

The Cytotoxic T-Lymphocyte Associated Protein 4 (CTLA4) Epitope Mapping Peptide Array is a semi-quantitative array displaying 177 synthesized peptides representing the full-length CTLA4. It is suitable for antibody epitope mapping and detection of IgG, IgA, IgM, IgE, etc. in serum, plasma, and many other liquid sample types.

For a service quote, please fill out the Epitope Mapping Array Quote Request Form.

[Price not listed]  
PAH-CTLA4-G1

Assay Format

Species Detected:
  • Human
Compatible Sample Types:
  • Ascites
  • DNA Aptamers
  • Hybridoma cell culture medium
  • Other fluids
  • Plasma
  • Purified antibodies
  • Purified protein
  • Serum
Method of Detection:
Fluorescence Laser Scanner
Quantitative/Semi-Quantitative:
  • Semi-Quantitative
Solid Support:
Glass Slide
Antibody Type:
Human IgG, mouse IgG, other isotypes (IgA, IgM, IgE, etc.) derived from most animals, upon request.

Product Specifications

Size:
1, 2, or 4 Slide Kit

Protein Information

Accession Number:
  • P16410
Gene Symbols:
  • CTLA4
Protein Name & Synonyms:
CTLA-4 / CD152
Target Species:
Human
Synthesized Protein Sequence:
188 amino acids (Lys36-Asn223, without N-terminal signal peptide)
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Peptide Information

Number of Peptides:
177
Peptide Length:
12-mer
Peptide Offset:
1-mer
Peptide Purity:
HPLC grade, >95% purity
Array Printing Replicate:
Triplicate

Peptide Sequence

1. KAMHVAQPAVVL 46. VTEVCAATYMMG 91. LYICKVELMYPP 136. SSGLFFYSFLLT
2. AMHVAQPAVVLA 47. TEVCAATYMMGN 92. YICKVELMYPPP 137. SGLFFYSFLLTA
3. MHVAQPAVVLAS 48. EVCAATYMMGNE 93. ICKVELMYPPPY 138. GLFFYSFLLTAV
4. HVAQPAVVLASS 49. VCAATYMMGNEL 94. CKVELMYPPPYY 139. LFFYSFLLTAVS
5. VAQPAVVLASSR 50. CAATYMMGNELT 95. KVELMYPPPYYL 140. FFYSFLLTAVSL
6. AQPAVVLASSRG 51. AATYMMGNELTF 96. VELMYPPPYYLG 141. FYSFLLTAVSLS
7. QPAVVLASSRGI 52. ATYMMGNELTFL 97. ELMYPPPYYLGI 142. YSFLLTAVSLSK
8. PAVVLASSRGIA 53. TYMMGNELTFLD 98. LMYPPPYYLGIG 143. SFLLTAVSLSKM
9. AVVLASSRGIAS 54. YMMGNELTFLDD 99. MYPPPYYLGIGN 144. FLLTAVSLSKML
10. VVLASSRGIASF 55. MMGNELTFLDDS 100. YPPPYYLGIGNG 145. LLTAVSLSKMLK
11. VLASSRGIASFV 56. MGNELTFLDDSI 101. PPPYYLGIGNGT 146. LTAVSLSKMLKK
12. LASSRGIASFVC 57. GNELTFLDDSIC 102. PPYYLGIGNGTQ 147. TAVSLSKMLKKR
13. ASSRGIASFVCE 58. NELTFLDDSICT 103. PYYLGIGNGTQI 148. AVSLSKMLKKRS
14. SSRGIASFVCEY 59. ELTFLDDSICTG 104. YYLGIGNGTQIY 149. VSLSKMLKKRSP
15. SRGIASFVCEYA 60. LTFLDDSICTGT 105. YLGIGNGTQIYV 150. SLSKMLKKRSPL
16. RGIASFVCEYAS 61. TFLDDSICTGTS 106. LGIGNGTQIYVI 151. LSKMLKKRSPLT
17. GIASFVCEYASP 62. FLDDSICTGTSS 107. GIGNGTQIYVID 152. SKMLKKRSPLTT
18. IASFVCEYASPG 63. LDDSICTGTSSG 108. IGNGTQIYVIDP 153. KMLKKRSPLTTG
19. ASFVCEYASPGK 64. DDSICTGTSSGN 109. GNGTQIYVIDPE 154. MLKKRSPLTTGV
20. SFVCEYASPGKA 65. DSICTGTSSGNQ 110. NGTQIYVIDPEP 155. LKKRSPLTTGVY
21. FVCEYASPGKAT 66. SICTGTSSGNQV 111. GTQIYVIDPEPC 156. KKRSPLTTGVYV
22. VCEYASPGKATE 67. ICTGTSSGNQVN 112. TQIYVIDPEPCP 157. KRSPLTTGVYVK
23. CEYASPGKATEV 68. CTGTSSGNQVNL 113. QIYVIDPEPCPD 158. RSPLTTGVYVKM
24. EYASPGKATEVR 69. TGTSSGNQVNLT 114. IYVIDPEPCPDS 159. SPLTTGVYVKMP
25. YASPGKATEVRV 70. GTSSGNQVNLTI 115. YVIDPEPCPDSD 160. PLTTGVYVKMPP
26. ASPGKATEVRVT 71. TSSGNQVNLTIQ 116. VIDPEPCPDSDF 161. LTTGVYVKMPPT
27. SPGKATEVRVTV 72. SSGNQVNLTIQG 117. IDPEPCPDSDFL 162. TTGVYVKMPPTE
28. PGKATEVRVTVL 73. SGNQVNLTIQGL 118. DPEPCPDSDFLL 163. TGVYVKMPPTEP
29. GKATEVRVTVLR 74. GNQVNLTIQGLR 119. PEPCPDSDFLLW 164. GVYVKMPPTEPE
30. KATEVRVTVLRQ 75. NQVNLTIQGLRA 120. EPCPDSDFLLWI 165. VYVKMPPTEPEC
31. ATEVRVTVLRQA 76. QVNLTIQGLRAM 121. PCPDSDFLLWIL 166. YVKMPPTEPECE
32. TEVRVTVLRQAD 77. VNLTIQGLRAMD 122. CPDSDFLLWILA 167. VKMPPTEPECEK
33. EVRVTVLRQADS 78. NLTIQGLRAMDT 123. PDSDFLLWILAA 168. KMPPTEPECEKQ
34. VRVTVLRQADSQ 79. LTIQGLRAMDTG 124. DSDFLLWILAAV 169. MPPTEPECEKQF
35. RVTVLRQADSQV 80. TIQGLRAMDTGL 125. SDFLLWILAAVS 170. PPTEPECEKQFQ
36. VTVLRQADSQVT 81. IQGLRAMDTGLY 126. DFLLWILAAVSS 171. PTEPECEKQFQP
37. TVLRQADSQVTE 82. QGLRAMDTGLYI 127. FLLWILAAVSSG 172. TEPECEKQFQPY
38. VLRQADSQVTEV 83. GLRAMDTGLYIC 128. LLWILAAVSSGL 173. EPECEKQFQPYF
39. LRQADSQVTEVC 84. LRAMDTGLYICK 129. LWILAAVSSGLF 174. PECEKQFQPYFI
40. RQADSQVTEVCA 85. RAMDTGLYICKV 130. WILAAVSSGLFF 175. ECEKQFQPYFIP
41. QADSQVTEVCAA 86. AMDTGLYICKVE 131. ILAAVSSGLFFY 176. CEKQFQPYFIPI
42. ADSQVTEVCAAT 87. MDTGLYICKVEL 132. LAAVSSGLFFYS 177. EKQFQPYFIPIN
43. DSQVTEVCAATY 88. DTGLYICKVELM 133. AAVSSGLFFYSF
44. SQVTEVCAATYM 89. TGLYICKVELMY 134. AVSSGLFFYSFL
45. QVTEVCAATYMM 90. GLYICKVELMYP 135. VSSGLFFYSFLL

Application Notes

  • Identify high antigenicity epitopes for antibody production & vaccine development
  • Locate (auto)antigen epitopes of (auto)antibodies
  • Define the best antibody clone against the protein-of-interest
  • Perform epitope mutant analysis
  • Map B cell epitopes

Service Features

  • Small serum sample volume required (2 µl)
  • High density (simultaneously analyze hundreds of overlapping peptides)
  • High sensitivity
  • Large dynamic range
  • Suitable for high-throughput assays
  • High efficiency and accuracy
  • Affordable, quick and simple to use

Kit Components

  • RayBio® human CLTA-4 protein peptide array
  • Blocking Buffer
  • Wash Buffer I
  • Wash Buffer II
  • Biotin-conjugated secondary antibody
  • Cy3 equivalent dye conjugated streptavidin
  • Array accessories (including slide incubation chamber assembly, gasket, adhesive plastic strips, etc.)

Other Materials Required

  • Distilled water
  • Small plastic boxes or containers
  • Orbital shaker or oscillating rocker
  • Pipettors, pipette tips and other common lab consumables
  • Aluminum foil
  • Laser fluorescence scanner

View Compatible Laser Scanners

Don't have a compatible scanner? RayBiotech now offers FREE scanning service for all RayBio glass slide antibody arrays! Learn More

Storage/Stability

Upon receipt, all kit components should be stored at -20 °C to -80 °C until ready to use. Stored properly, the kit will retain complete activity for up to 6 months.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Amazon Gift Card Program