Goat Anti-Human CD284 (N-term.)

Goat Anti-Human CD284 (N-term.) (0.1 mg)

129-10142
+

Antigen Information

Protein Name & Synonyms:
CD284
Target Species:
  • Human

Antibody Specifications

Applications:
Immunohistology - Paraffin, Western Blotting
Concentration:
1.0mg/ml
Host Species:
Goat
Immunogen Sequence:
LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC
Species Reactivity:
Human, Mouse, Rat

Specificity

This product specifically recognizes an epitope within the N-terminal (NT) region of CD284, also known as Toll-like receptor 4 (TLR4), a highly conserved member of the toll-like receptor family, expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells, which plays a primary role in the activation of innate immunity.

CD284 acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.

This product is reported as suitable for use in immunocytochemistry on acetone fixed cells.

Storage/Stability

Store at +4 °C or at -20 °C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.

Format

Supplied as:
Purified IgG - liquid
Formulation:
Phosphate buffered saline
Format Type:
Purified

Preparation

Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.

Immunogen:
Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
Preservative:
0.1% Sodium Azide (NaN3)
0.1% Bovine Serum Albumin

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.