Mouse Anti-Human AKAP4

Human AKAP4 monoclonal antibody (100 ug)

$412.00  
101-10048
+

Antigen Information

Accession Number:
  • NP_003877
Gene ID:
  • 8852
Gene Symbols:
  • AKAP4
Protein Name & Synonyms:
AKAP4
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Concentration:
1 mg/ml
Host Species:
Mouse
Immunogen Sequence:
MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRK VICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEII VIKDTEKKDQSKTEGSVCLF
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG3 Kappa

Synonyms

AKAP82, FSC1, HI, hAKAP82, p82

Description

Mouse monoclonal antibody raised against a partial recombinant AKAP4.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_003886

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
AKAP4 monoclonal antibody Western Blot analysis of AKAP4 expression in K-562 .

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.