Mouse Anti-Human ATP1A3

Human ATP1A3 monoclonal antibody (200 uL)

$412.00
101-10121
+

Antigen Information

Accession Number:
  • NP_689509.1
Gene ID:
  • 478
Gene Symbols:
  • ATP1A3
Protein Name & Synonyms:
ATP1A3
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Concentration:
2.032 mg/ml
Host Species:
Mouse
Immunogen Sequence:
NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVV VQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFL SYCPGMDVALRMYPLKPSWWFCAFPY
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgM Kappa

Synonyms

DYT12, MGC13276, RDP

Description

Mouse monoclonal antibody raised against a partial recombinant ATP1A3.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_152296

Preparation

Storage Buffer
Ascites fluid

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.