Mouse Anti-Human CCT2

Human CCT2 monoclonal antibody (100 ug)
CODE:  101-10238

Antigen Information

Accession Number:
  • NP_006422
Gene ID:
  • 10576
Gene Symbols:
  • CCT2
Protein Name & Synonyms:
CCT2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB, Immunofluorescence
Host Species:
Mouse
Immunogen Sequence:
IAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFR QDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNL EAIHIIKKLGGSLADSYLDEG
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

99D8.1, CCT-beta, CCTB, MGC142074, MGC142076, PRO1633, TCP-1-beta

Description

Mouse monoclonal antibody raised against a partial recombinant CCT2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_006431

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.85 KDa).
CCT2 monoclonal antibody Western Blot analysis of CCT2 expression in A-431 .
Immunofluorescence of monoclonal antibody to CCT2 on A-431 cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged CCT2 is 0.03 ng/ml as a capture antibody.
Detection limit for recombinant GST tagged CCT2 is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.