Mouse Anti-Human CLGN

Human CLGN monoclonal antibody (100 ug)

$376.00  
101-10306
+

Product Specifications

Size:
100 ug

Protein Information

Accession Number:
  • NP_004353.1
Gene ID:
  • 1047
Gene Symbols:
  • CLGN
Protein Name & Synonyms:
CLGN
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEV YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL KENQVPGDRGLVLKSRAKHH
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

None

Description

Mouse monoclonal antibody raised against a partial recombinant CLGN.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_004362

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Detection limit for recombinant GST tagged CLGN is 0.1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.