Mouse Anti-Human CYLD

Human CYLD monoclonal antibody (100 ug)

101-10364
+

Antigen Information

Accession Number:
  • AAH12342
Gene ID:
  • 1540
Gene Symbols:
  • CYLD
Protein Name & Synonyms:
CYLD
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA
Concentration:
1mg/ml
Host Species:
Mouse
Immunogen Sequence:
QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDG GQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCAR RLLCDAYMCMYQSPTMSLYK
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CDMT, CYLD1, CYLDI, EAC, FLJ20180, FLJ31664, FLJ78684, HSPC057, KIAA0849, MFT, MFT1, SBS, TEM, USPL2

Description

Mouse monoclonal antibody raised against a partial recombinant CYLD.

Source

Specificity
Human

Gene Information

Gene Accession #
BC012342

Preparation

Storage Buffer
1x PBS, pH 7.4

 

Immunofluorescence of monoclonal antibody to CYLD on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged CYLD is 0.1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.