See description below for image caption

Mouse Anti-Human FBN2

Human FBN2 monoclonal antibody (100 ug)

$412.00  
101-10510
+

Antigen Information

Accession Number:
  • NP_001990.2
Gene ID:
  • 2201
Gene Symbols:
  • FBN2
Protein Name & Synonyms:
FBN2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSK EHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSY LHTAKKKLMPGTYTLEITSIP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CCA, DA9

Description

Mouse monoclonal antibody raised against a partial recombinant FBN2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_001999

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.85 KDa).
Detection limit for recombinant GST tagged FBN2 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.