Mouse Anti-Human FLJ23834

Human FLJ23834 monoclonal antibody (100 ug)

$412.00
101-10547
+

Antigen Information

Accession Number:
  • NP_689963
Gene ID:
  • 222256
Gene Symbols:
  • FLJ23834
Protein Name & Synonyms:
FLJ23834
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Concentration:
0.5 mg/ml
Host Species:
Mouse
Immunogen Sequence:
IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESS HQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLG SRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

FLJ43271, MGC133292, MGC133293

Description

Mouse monoclonal antibody raised against a partial recombinant FLJ23834.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_152750

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.84 KDa).
Immunofluorescence of monoclonal antibody to FLJ23834 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged FLJ23834 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.