Mouse Anti-Human FLT3

Human FLT3 monoclonal antibody (100 ug)
CODE:  101-10550

Antigen Information

Accession Number:
  • NP_004110
Gene ID:
  • 2322
Gene Symbols:
  • FLT3
Protein Name & Synonyms:
FLT3
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA
Concentration:
0.5mg/ml
Host Species:
Mouse
Immunogen Sequence:
LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVI LKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRR PYFRKMENQDALVCISESVP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CD135, FLK2, STK1

Description

Mouse monoclonal antibody raised against a partial recombinant FLT3.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_004119

Preparation

Storage Buffer
1x PBS, pH 7.4

 

Immunofluorescence of monoclonal antibody to FLT3 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.