Mouse Anti-Human FOXL1

Human FOXL1 monoclonal antibody (100 ug)

$412.00  
101-10563
+

Antigen Information

Accession Number:
  • NP_005241
Gene ID:
  • 2300
Gene Symbols:
  • FOXL1
Protein Name & Synonyms:
FOXL1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPE AGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGT ASPNEDAGDAAQGAAAVAVGQAARTGDGP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

FKH6, FKHL11, FREAC7

Description

Mouse monoclonal antibody raised against a partial recombinant FOXL1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_005250

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.99 KDa).
FOXL1 monoclonal antibody Western Blot analysis of FOXL1 expression in Daoy.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.