Mouse Anti-Human GNL3

Human GNL3 monoclonal antibody (100 ug)

101-10648
+

Antigen Information

Accession Number:
  • AAH01024.1
Gene ID:
  • 26354
Gene Symbols:
  • GNL3
Protein Name & Synonyms:
GNL3
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTM LAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPT SWTPPPYFNESIVVDMKSGF
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

C77032, E2IG3, MGC800, NS

Description

Mouse monoclonal antibody raised against a full length recombinant GNL3.

Source

Specificity
Human

Gene Information

Gene Accession #
BC001024

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
Western Blot analysis of GNL3 expression in transfected 293T cell line by GNL3 monoclonal antibody. Lane 1: GNL3 transfected lysate (Predicted MW: 62 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged GNL3 is 0.1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.