Mouse Anti-Human HLA-DQA1

Human HLA-DQA1 monoclonal antibody (100 ug)

$412.00
101-10719
+

Antigen Information

Accession Number:
  • NP_002113.2
Gene ID:
  • 3117
Gene Symbols:
  • HLA-DQA1
Protein Name & Synonyms:
HLA-DQA1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, Proximity Ligation Analysis, WB
Host Species:
Mouse
Immunogen Sequence:
EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLE RKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRY NSTAATN
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CD, CELIAC1, DQ-A1, FLJ27088, FLJ27328, GSE, HLA-DQA, MGC149527

Description

Mouse monoclonal antibody raised against a partial recombinant HLA-DQA1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_002122

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.31 KDa).
Proximity Ligation Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged HLA-DQA1 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.