Mouse Anti-Human HOXA5

Human HOXA5 monoclonal antibody (100 ug)

$412.00  
101-10731
+

Antigen Information

Accession Number:
  • NP_061975.1
Gene ID:
  • 3202
Gene Symbols:
  • HOXA5
Protein Name & Synonyms:
HOXA5
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLEL EKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW KKDNKLKSMSMAAAGGAFRP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

HOX1, HOX1.3, HOX1C, MGC9376

Description

Mouse monoclonal antibody raised against a partial recombinant HOXA5.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_019102.1

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
Immunofluorescence of monoclonal antibody to HOXA5 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged HOXA5 is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.