Mouse Anti-Human HSD17B1

Human HSD17B1 monoclonal antibody (200 uL)

$412.00
101-10752
+

Antigen Information

Accession Number:
  • NP_000404
Gene ID:
  • 3292
Gene Symbols:
  • HSD17B1
Protein Name & Synonyms:
HSD17B1
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFR EAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRL DDPSGSNYVTAMHREVF
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1

Description

Mouse monoclonal antibody raised against a partial recombinant HSD17B1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_000413

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (36.41 KDa).
HSD17B1 monoclonal antibody Western Blot analysis of HSD17B1 expression in Jurkat .

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.