Mouse Anti-Human IL12RB2

Human IL12RB2 monoclonal antibody (100 ug)

101-10794
+

Antigen Information

Accession Number:
  • NP_001550
Gene ID:
  • 3595
Gene Symbols:
  • IL12RB2
Protein Name & Synonyms:
IL12RB2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

None

Description

Mouse monoclonal antibody raised against a partial recombinant IL12RB2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_001559

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.84 KDa).
Detection limit for recombinant GST tagged IL12RB2 is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.