Mouse Anti-Human IL1RAP

Human IL1RAP monoclonal antibody (100 ug)

101-10805
+

Antigen Information

Accession Number:
  • AAH53621.1
Gene ID:
  • 3556
Gene Symbols:
  • IL1RAP
Protein Name & Synonyms:
IL1RAP
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Concentration:
1mg/ml
Host Species:
Mouse
Immunogen Sequence:
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFED EPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLE EPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITC PNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL IALISNNGNYTCVVTYPENGRTFHLTRTPTVKVVGSPKNA VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK VTSEDLKRSYVCHARSAKGEVAKAAKVKQKGNRCGQ
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

C3orf13, FLJ37788, IL-1RAcP, IL1R3

Description

Mouse monoclonal antibody raised against a full length recombinant IL1RAP.

Source

Specificity
Human

Gene Information

Gene Accession #
BC053621

Preparation

Storage Buffer
1x PBS, pH 7.4

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.