Mouse Anti-Human IRAK3

Human IRAK3 monoclonal antibody (100 ug)

$412.00
101-10825
+

Antigen Information

Accession Number:
  • AAH57800
Gene ID:
  • 11213
Gene Symbols:
  • IRAK3
Protein Name & Synonyms:
IRAK3
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Concentration:
1 mg/ml
Host Species:
Mouse
Immunogen Sequence:
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPS SSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRP VESSCSSKFSWDEYEQYKKE
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

ASRT5, FLJ13601, IRAK-M, IRAKM

Description

Mouse monoclonal antibody raised against a partial recombinant IRAK3.

Source

Specificity
Human

Gene Information

Gene Accession #
BC057800

Preparation

Storage Buffer
1x PBS, pH 7.4

Western Blot detection against Immunogen (36.63 KDa).
IRAK3 monoclonal antibody Western Blot analysis of IRAK3 expression in HeLa .
Detection limit for recombinant GST tagged IRAK3 is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Related Products Related Products