Mouse Anti-Human LBP

Human LBP monoclonal antibody (200 uL)

$412.00
101-10895
+

Antigen Information

Accession Number:
  • AAH22256
Gene ID:
  • 3929
Gene Symbols:
  • LBP
Protein Name & Synonyms:
LBP
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGD LRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSI SDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISVDLLLG SESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQI ESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAA VMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITD DMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPS APLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVAT NVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQI HKDFPSRRDHPP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgM Kappa

Synonyms

MGC22233

Description

Mouse monoclonal antibody raised against a full-length recombinant LBP.

Source

Specificity
Human

Gene Information

Gene Accession #
BC022256

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (75.46 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.