Mouse Anti-Human NFYB

Human NFYB monoclonal antibody (100 ug)

$376.00  
101-11107
+

Product Specifications

Size:
100 ug

Protein Information

Accession Number:
  • AAH05317
Gene ID:
  • 4801
Gene Symbols:
  • NFYB
Protein Name & Synonyms:
NFYB
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CBF-A, CBF-B, HAP3, NF-YB

Description

Mouse monoclonal antibody raised against a full length recombinant NFYB.

Source

Specificity
Human

Gene Information

Gene Accession #
BC005317

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (48.51 KDa).
Immunofluorescence of monoclonal antibody to NFYB on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged NFYB is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.