Mouse Anti-Human PCDHB16

Human PCDHB16 monoclonal antibody (200 uL)

101-11208
+

Antigen Information

Accession Number:
  • AAH36062.1
Gene ID:
  • 57717
Gene Symbols:
  • PCDHB16
Protein Name & Synonyms:
PCDHB16
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
MEIGWMHNRRQRQVLVFFVLLSLSGAGAELGSYSVVEETE RGSFVANLGKDLGLGLTEMSTRKARIISQGNKQHLQLKAQ TGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAE LRVIDINDHSPMFTEKEMILKIPENSPLGTEFPLNHALDL DVGSNNVQNYKISPSSHFRVLIHEFRDGRKYPELVLDKEL DREEEPQLRLTLTALDGGSPPRSGTAQVRIEVVDINDNAP EFEQPIYKVQIPENSPLGSLVATVSARDLDGGANGKISYT LFQPSEDISKTLEVNPMTGEVRLRKQVDFEMVTSYEVRIK ATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIAENS PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNF YTLVTERALDREARAEYNITLTVTDMGTPRLKTEHNITVQ ISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDS GTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLD YEALQAFEFRVGATDRGSPALSREALVRVLVLDANDNSPL VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA WLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKQRL VVLVKDNGEPPRSATATLHVLLVDGFSQPFLPLPEAAPGQ TQANSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAA SVGRCSMPEGPFPGRLVDVSGTGTLSQSYQYEVCLTGGSE TSEFKFLKPIIPNFSP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

KIAA1621, ME1, PCDH-BETA16, PCDH3X, PCDHB8a

Description

Mouse monoclonal antibody raised against a full-length recombinant PCDHB16.

Source

Specificity
Human

Gene Information

Gene Accession #
BC036062

Preparation

Storage Buffer
Ascites fluid

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.