Mouse Anti-Human PLA2G1B

Human PLA2G1B monoclonal antibody (100 ug)
CODE:  101-11273

Antigen Information

Accession Number:
  • AAH05386
Gene ID:
  • 5319
Gene Symbols:
  • PLA2G1B
Protein Name & Synonyms:
PLA2G1B
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGS GTPVDELDKQKQRV
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

MGC119834, MGC119835, PLA2, PLA2A, PPLA2

Description

Mouse monoclonal antibody raised against a full length recombinant PLA2G1B.

Source

Specificity
Human

Gene Information

Gene Accession #
BC005386

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (31.68 KDa).
Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B monoclonal antibody. Lane 1: PLA2G1B transfected lysate (Predicted MW: 16.4 KDa). Lane 2: Non-transfected lysate.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.