Mouse Anti-Human PMS2

Human PMS2 monoclonal antibody (100 ug)

$412.00
101-11285
+

Antigen Information

Accession Number:
  • NP_000526
Gene ID:
  • 5395
Gene Symbols:
  • PMS2
Protein Name & Synonyms:
PMS2
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA
Host Species:
Mouse
Immunogen Sequence:
ERAKLISLPTSKNWTFGPQDVDELIFMLSDSPGVMCRPSR VKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHPWN CPHGRPTMRHIANLGVISQN
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

HNPCC4, PMS2CL, PMSL2

Description

Mouse monoclonal antibody raised against a partial recombinant PMS2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_000535

Preparation

Storage Buffer
1x PBS, pH 7.2

Immunofluorescence of monoclonal antibody to PMS2 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged PMS2 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.