Mouse Anti-Human PPP1R14A

Human PPP1R14A monoclonal antibody (100 ug)

$412.00  
101-11305
+

Antigen Information

Accession Number:
  • AAH21089
Gene ID:
  • 94274
Gene Symbols:
  • PPP1R14A
Protein Name & Synonyms:
PPP1R14A
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Clone:
3A7
Concentration:
0.3 mg/ml
Host Species:
Mouse
Immunogen Sequence:
MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVK YDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDEL LELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHR QPGLRQPSPSHDGSLSPLQDRARTAHP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

CPI-17, CPI17, PPP1INL

Description

Mouse monoclonal antibody raised against a full length recombinant PPP1R14A.

Source

Specificity
Human

Gene Information

Gene Accession #
BC021089

Preparation

Storage Buffer
1x PBS, pH 7.4

Western Blot detection against Immunogen (41.91 KDa).
Western Blot analysis of PPP1R14A expression in transfected 293T cell line by PPP1R14A monoclonal antibody. Lane 1: PPP1R14A transfected lysate(16.7 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged PPP1R14A is approximately 0.1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.