See description below for image caption

Mouse Anti-Human PUM2

Human PUM2 monoclonal antibody (200 uL)

$412.00  
101-11366
+

Antigen Information

Accession Number:
  • NP_056132
Gene ID:
  • 23369
Gene Symbols:
  • PUM2
Protein Name & Synonyms:
PUM2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHG SRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVI QKFFEFGSLDQKLALATR
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2

Description

Mouse monoclonal antibody raised against a partial recombinant PUM2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_015317

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (36.52 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.