Mouse Anti-Human REG1A

Human REG1A monoclonal antibody (100 ug)

101-11434
+

Antigen Information

Accession Number:
  • AAH05350
Gene ID:
  • 5967
Gene Symbols:
  • REG1A
Protein Name & Synonyms:
REG1A
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
MNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPK KNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGF QKWKDVPCEDKFSFVCKFKN
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG

Description

Mouse monoclonal antibody raised against a partial recombinant REG1A.

Source

Specificity
Human

Gene Information

Gene Accession #
BC005350

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged REG1A is approximately 3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.