Mouse Anti-Human S100A9

Human S100A9 monoclonal antibody (100 ug)

$412.00
101-11511
+

Antigen Information

Accession Number:
  • AAH47681
Gene ID:
  • 6280
Gene Symbols:
  • S100A9
Protein Name & Synonyms:
S100A9
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKEL VRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFI MLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14

Description

Mouse monoclonal antibody raised against a full-length recombinant S100A9.

Source

Specificity
Human

Gene Information

Gene Accession #
BC047681

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (38.28 KDa).
S100A9 monoclonal antibody Western Blot analysis of S100A9 expression in human kidney.
Detection limit for recombinant GST tagged S100A9 is 0.03 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.