770-729-2992

RayBiotech is closed for Thanksgiving 11/26 - 11/27

Mouse Anti-Human SLC25A6

Human SLC25A6 monoclonal antibody (100 ug)

$412.00  
101-11570
+

Antigen Information

Accession Number:
  • NP_001627
Gene ID:
  • 293
Gene Symbols:
  • SLC25A6
Protein Name & Synonyms:
SLC25A6
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Concentration:
0.43 mg/ml
Host Species:
Mouse
Immunogen Sequence:
DFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLY QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTH
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG3 Kappa

Synonyms

AAC3, ANT3, ANT3Y, MGC17525

Description

Mouse monoclonal antibody raised against a partial recombinant SLC25A6.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_001636

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (33.99 KDa).
Detection limit for recombinant GST tagged SLC25A6 is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.