Mouse Anti-Human SOX18

Human SOX18 monoclonal antibody (200 uL)

$412.00
101-11636
+

Antigen Information

Accession Number:
  • NP_060889
Gene ID:
  • 54345
Gene Symbols:
  • SOX18
Protein Name & Synonyms:
SOX18
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKR LAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLR VQHLRDHP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

HLTS

Description

Mouse monoclonal antibody raised against a partial recombinant SOX18.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_018419

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (35.42 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.