Mouse Anti-Human SPG3A

Human SPG3A monoclonal antibody (100 ug)

$412.00
101-11649
+

Antigen Information

Accession Number:
  • NP_056999
Gene ID:
  • 51062
Gene Symbols:
  • ATL1
Protein Name & Synonyms:
SPG3A
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIV KDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGK SFLMDFMLRYMYNQESVDWV
Species Reactivity:
Human, Rat
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1

Description

Mouse monoclonal antibody raised against a partial recombinant SPG3A.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_015915

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in PC-12 .
SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in IMR-32 .
Detection limit for recombinant GST tagged SPG3A is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.