Mouse Anti-Human SULF1

Human SULF1 monoclonal antibody (200 uL)

101-11692
+

Antigen Information

Accession Number:
  • NP_055985.1
Gene ID:
  • 23213
Gene Symbols:
  • SULF1
Protein Name & Synonyms:
SULF1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVER GILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYD LHRGQLWDGWEG
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgM Kappa

Synonyms

FLJ30905, FLJ38022, FLJ41750, HSULF-1, KIAA1077, SULF-1

Description

Mouse monoclonal antibody raised against a partial recombinant SULF1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_015170

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (35.86 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.