Mouse Anti-Human SULT1C2

Human SULT1C2 monoclonal antibody (100 ug)

$412.00
101-11694
+

Antigen Information

Accession Number:
  • AAH58861.1
Gene ID:
  • 27233
Gene Symbols:
  • SULT1C4
Protein Name & Synonyms:
SULT1C2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWN FQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRA PTHQRFPFLEMKIPSLGSGEYK
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

MGC149521, MGC34422, SULT1C, SULT1C2

Description

Mouse monoclonal antibody raised against a partial recombinant SULT1C2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC058861

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.96 KDa).
Detection limit for recombinant GST tagged SULT1C4 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.