Mouse Anti-Human TCOF1

Human TCOF1 monoclonal antibody (100 ug)

101-11759
+

Antigen Information

Accession Number:
  • NP_001008657
Gene ID:
  • 6949
Gene Symbols:
  • TCOF1
Protein Name & Synonyms:
TCOF1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, Immunofluorescence, WB
Host Species:
Mouse
Immunogen Sequence:
AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLA QPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDP I
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

MFD1, treacle

Description

Mouse monoclonal antibody raised against a partial recombinant TCOF1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_001008657

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (34.65 KDa).
Western Blot analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody. Lane 1: TCOF1 transfected lysate(152.104 KDa). Lane 2: Non-transfected lysate.
Immunofluorescence of monoclonal antibody to TCOF1 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged TCOF1 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.