Mouse Anti-Human TRIB3

Human TRIB3 monoclonal antibody (100 ug)
CODE:  101-11839

Antigen Information

Accession Number:
  • AAH27484
Gene ID:
  • 57761
Gene Symbols:
  • TRIB3
Protein Name & Synonyms:
TRIB3
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYT CKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYA FFTRTHGDMH
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

C20orf97, NIPK, SINK, SKIP3, TRB3

Description

Mouse monoclonal antibody raised against a partial recombinant TRIB3.

Source

Specificity
Human

Gene Information

Gene Accession #
BC027484

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.53 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.