Mouse Anti-Human UBE2L6

Human UBE2L6 monoclonal antibody (100 ug)
CODE:  101-11883

Antigen Information

Accession Number:
  • AAH32491
Gene ID:
  • 9246
Gene Symbols:
  • UBE2L6
Protein Name & Synonyms:
UBE2L6
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLL PDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVD ENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREP LRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

MGC40331, RIG-B, UBCH8

Description

Mouse monoclonal antibody raised against a full length recombinant UBE2L6.

Source

Specificity
Human

Gene Information

Gene Accession #
BC032491

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (42.57 KDa).
Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody -1F4. Lane 1: UBE2L6 transfected lysate(17.595 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged UBE2L6 is 3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.