Mouse Anti-Human USO1

Human USO1 monoclonal antibody (100 ug)

$412.00
101-11909
+

Antigen Information

Accession Number:
  • AAH32654
Gene ID:
  • 8615
Gene Symbols:
  • USO1
Protein Name & Synonyms:
USO1
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, IHC, WB
Host Species:
Mouse
Immunogen Sequence:
MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRR NAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIG YALDTLYNIISNEEEEVEENSTRQSEDLGSQFTEIFIKQQ ENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQII LVSPMGVSRLMDLLADSREVIRNDGVLLLQALTRSNGAIQ KIVAFENAFERLLDIISEEGNSDGGIVVEDCLILLQNLLK NNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLH LMLQLVRVLVSPTNPPGATSSCQKAMFQCGLLQQLCTILM ATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNPP RPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQG EIVSTLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAA VALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTNI LSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPF LTGQIAENLGEEEQLVQGLCALLLGISIYFNDNSLESYMK EKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNF PSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEV KKTLEQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNE QLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEG AQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIE NMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQL NSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIAT KTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSS NSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKIL SLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDH I
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

P115, TAP, VDP

Description

Mouse monoclonal antibody raised against a full-length recombinant USO1.

Source

Specificity
Human

Gene Information

Gene Accession #
BC032654

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (131.45 KDa).
USO1 monoclonal antibody Western Blot analysis of USO1 expression in HeLa .
Immunoperoxidase of monoclonal antibody to USO1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Immunofluorescence of monoclonal antibody to USO1 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged USO1 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.