See description below for image caption

Mouse Anti-Human VAC14

Human VAC14 monoclonal antibody (100 ug)

$412.00  
101-11918
+

Antigen Information

Accession Number:
  • NP_060522.3
Gene ID:
  • 55697
Gene Symbols:
  • VAC14
Protein Name & Synonyms:
VAC14
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQ HFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

ArPIKfyve, FLJ10305, FLJ36622, FLJ46582, MGC149815, MGC149816, TAX1BP2, TRX

Description

Mouse monoclonal antibody raised against a partial recombinant VAC14.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_018052

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (33.33 KDa).
Western Blot analysis of VAC14 expression in transfected 293T cell line by VAC14 monoclonal antibody. Lane 1: VAC14 transfected lysate (Predicted MW: 88 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.