Mouse Anti-Human XRCC6

$412.00
101-11945


Human XRCC6 monoclonal antibody (100 ug)

+

Antigen Information

Accession Number:
  • AAH18259
Gene ID:
  • 2547
Gene Symbol:
  • XRCC6
Protein Name & Synonyms:
XRCC6
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIF LVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD QFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFL DLMHLKKPGGFDISLFYRDTISIAEDEDLRVHFEESSKLE DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH YLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFA DDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGS LVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL EALTKHFQD
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CTC75, CTCBF, G22P1, KU70, ML8, TLAA

Description

Mouse monoclonal antibody raised against a full-length recombinant XRCC6.

Source

Specificity
Human

Gene Information

Gene Accession #
BC018259

Preparation

Storage Buffer
1x PBS, pH 7.2

XRCC6 monoclonal antibody. Western Blot analysis of XRCC6 expression in Hela NE .
Immunofluorescence of monoclonal antibody to XRCC6 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged XRCC6 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. International

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Cart content Cart content