1-888-494-8555

5% Off All Online Orders

Mouse Anti-Human XRCC6

$412.00
101-11945


Human XRCC6 monoclonal antibody (100 ug)

+

Antigen Information

Gene Symbol:
  • XRCC6
Target Species:
Human

Product Specifications

Size:
100 ug

Antibody Specifications

Host Species:
Mouse
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CTC75, CTCBF, G22P1, KU70, ML8, TLAA

Description

Mouse monoclonal antibody raised against a full-length recombinant XRCC6.

Source

Specificity
Human
Host
Mouse
Isotype
IgG2a Kappa
Immunogen Sequence
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIF LVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELD QFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFL DLMHLKKPGGFDISLFYRDTISIAEDEDLRVHFEESSKLE DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHH YLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFA DDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGS LVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL EALTKHFQD
Protein Accession #
AAH18259

Gene Information

Gene Name
XRCC6
GeneID
2547
Gene Accession #
BC018259

Preparation

Storage Buffer
1x PBS, pH 7.2
Applications
Immunofluorescence, ELISA, WB

XRCC6 monoclonal antibody. Western Blot analysis of XRCC6 expression in Hela NE .
Immunofluorescence of monoclonal antibody to XRCC6 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged XRCC6 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Write A Review

No posts found

U.S. International

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Cart content Cart content