Mouse Anti-Human ZBTB16

Human ZBTB16 monoclonal antibody (100 ug)

$412.00  
101-11954
+

Antigen Information

Accession Number:
  • AAH29812
Gene ID:
  • 7704
Gene Symbols:
  • ZBTB16
Protein Name & Synonyms:
ZBTB16
Target Species:
  • Human

Antibody Specifications

Applications:
WB, Proximity Ligation Analysis, ELISA
Host Species:
Mouse
Immunogen Sequence:
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKA FVCDQCGAQFSKEDALETHR
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

PLZF, ZNF145

Description

Mouse monoclonal antibody raised against a partial recombinant ZBTB16.

Source

Specificity
Human

Gene Information

Gene Accession #
BC029812

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody. Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 KDa). Lane 2: Non-transfected lysate.
Proximity Ligation Analysis of protein-protein interactions between TRAF2 and ZBTB16 HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-ZBTB16 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.