Mouse Anti-Human ZNF394

Human ZNF394 monoclonal antibody (100 ug)

$412.00
101-11987
+

Antigen Information

Accession Number:
  • AAH25241
Gene ID:
  • 84124
Gene Symbols:
  • ZNF394
Protein Name & Synonyms:
ZNF394
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MNSSLTAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVK VEEDSPGSWEPNYPAASPDPETSRLHFRQLRYQEVAGPEE ALSRLRELCRRWLRPELLSKEQILELLVLEQFLTILPEEL QAWVREHCPESGEEAVAVVRALQRALDGTSSQGMVTFEDT AVSLTWEEWERLDPARRDFCRESAQKDSGSTVPPSLESRV ENKELIPMQQILEEAEPQGQLQEAFQGKRPLFSKCGSTHE DRVEKQSGDPLPLKLENSPEAEGLNSISDVNKNGSIEGED SKNNELQNSARCSNLVLCQHIPKAERPTDSEEHGNKCKQS FHMVTWHVLKPHKSDSGDSFHHSSLFETQRQLHEERPYKC GNCGKSFKQRSDLFRHQRIHTGEKPYGCQECGKSFSQSAA LTKHQRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDK HFKCEECGETCHISNLFRHQRLHKGERPYKCEECEKSFKQ RSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQRIHT GEKPYKCLECGERFRQSTHLIRHQRIHQNKVLSAGRGGSR L
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

FLJ12298, ZKSCAN14

Description

Mouse monoclonal antibody raised against a full length recombinant ZNF394.

Source

Specificity
Human

Gene Information

Gene Accession #
BC025241

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (87.45 KDa).
Immunofluorescence of monoclonal antibody to ZNF394 on HeLa cell. [antibody concentration 10 ug/ml]

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.