LAG-3 Epitope Mapping Peptide Array

The LAG-3 (Lymphocyte activation gene 3 protein/CD223) Epitope Mapping Peptide Array is a semi-quantitative array displaying 492 synthesized peptides representing the full-length LAG-3. It is suitable for antibody epitope mapping and detection of IgG, IgA, IgM, IgE, etc. in serum, plasma, and many other liquid sample types.

For a service quote, please fill out the Epitope Mapping Array Quote Request Form.

[Price not listed]  
PAH-LAG3-G1

Assay Format

Species Detected:
  • Human
Compatible Sample Types:
  • Ascites
  • DNA Aptamers
  • Hybridoma cell culture medium
  • Other fluids
  • Plasma
  • Purified antibodies
  • Purified protein
  • Serum
Method of Detection:
Fluorescence Laser Scanner
Quantitative/Semi-Quantitative:
  • Semi-Quantitative
Solid Support:
Glass Slide
Antibody Type:
Human IgG, mouse IgG, other isotypes (IgA, IgM, IgE, etc.) derived from most animals, upon request.

Product Specifications

Size:
1, 2, or 4 Slide Kit

Protein Information

Accession Number:
  • P18627
Gene Symbols:
  • LAG3
Protein Name & Synonyms:
LAG-3 / Lymphocyte activation gene 3 protein / CD223
Target Species:
Human
Synthesized Protein Sequence:
503 amino acids (Leu23-Leu525, without N-terminal signal peptide)
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL

Peptide Information

Number of Peptides:
492
Peptide Length:
12-mer
Peptide Offset:
1-mer
Peptide Purity:
HPLC grade, >95% purity
Array Printing Replicate:
Triplicate

Peptide Sequence

1. LQPGAEVPVVWA 2. QPGAEVPVVWAQ 3. PGAEVPVVWAQE 4. GAEVPVVWAQEG
5. AEVPVVWAQEGA 6. EVPVVWAQEGAP 7. VPVVWAQEGAPA 8. PVVWAQEGAPAQ
9. VVWAQEGAPAQL 10. VWAQEGAPAQLP 11. WAQEGAPAQLPC 12. AQEGAPAQLPCS
13. QEGAPAQLPCSP 14. EGAPAQLPCSPT 15. GAPAQLPCSPTI 16. APAQLPCSPTIP
17. PAQLPCSPTIPL 18. AQLPCSPTIPLQ 19. QLPCSPTIPLQD 20. LPCSPTIPLQDL
21. PCSPTIPLQDLS 22. CSPTIPLQDLSL 23. SPTIPLQDLSLL 24. PTIPLQDLSLLR
25. TIPLQDLSLLRR 26. IPLQDLSLLRRA 27. PLQDLSLLRRAG 28. LQDLSLLRRAGV
29. QDLSLLRRAGVT 30. DLSLLRRAGVTW 31. LSLLRRAGVTWQ 32. SLLRRAGVTWQH
33. LLRRAGVTWQHQ 34. LRRAGVTWQHQP 35. RRAGVTWQHQPD 36. RAGVTWQHQPDS
37. AGVTWQHQPDSG 38. GVTWQHQPDSGP 39. VTWQHQPDSGPP 40. TWQHQPDSGPPA
41. WQHQPDSGPPAA 42. QHQPDSGPPAAA 43. HQPDSGPPAAAP 44. QPDSGPPAAAPG
45. PDSGPPAAAPGH 46. DSGPPAAAPGHP 47. SGPPAAAPGHPL 48. GPPAAAPGHPLA
49. PPAAAPGHPLAP 50. PAAAPGHPLAPG 51. AAAPGHPLAPGP 52. AAPGHPLAPGPH
53. APGHPLAPGPHP 54. PGHPLAPGPHPA 55. GHPLAPGPHPAA 56. HPLAPGPHPAAP
57. PLAPGPHPAAPS 58. LAPGPHPAAPSS 59. APGPHPAAPSSW 60. PGPHPAAPSSWG
61. GPHPAAPSSWGP 62. PHPAAPSSWGPR 63. HPAAPSSWGPRP 64. PAAPSSWGPRPR
65. AAPSSWGPRPRR 66. APSSWGPRPRRY 67. PSSWGPRPRRYT 68. SSWGPRPRRYTV
69. SWGPRPRRYTVL 70. WGPRPRRYTVLS 71. GPRPRRYTVLSV 72. PRPRRYTVLSVG
73. RPRRYTVLSVGP 74. PRRYTVLSVGPG 75. RRYTVLSVGPGG 76. RYTVLSVGPGGL
77. YTVLSVGPGGLR 78. TVLSVGPGGLRS 79. VLSVGPGGLRSG 80. LSVGPGGLRSGR
81. SVGPGGLRSGRL 82. VGPGGLRSGRLP 83. GPGGLRSGRLPL 84. PGGLRSGRLPLQ
85. GGLRSGRLPLQP 86. GLRSGRLPLQPR 87. LRSGRLPLQPRV 88. RSGRLPLQPRVQ
89. SGRLPLQPRVQL 90. GRLPLQPRVQLD 91. RLPLQPRVQLDE 92. LPLQPRVQLDER
93. PLQPRVQLDERG 94. LQPRVQLDERGR 95. QPRVQLDERGRQ 96. PRVQLDERGRQR
97. RVQLDERGRQRG 98. VQLDERGRQRGD 99. QLDERGRQRGDF 100. LDERGRQRGDFS
101. DERGRQRGDFSL 102. ERGRQRGDFSLW 103. RGRQRGDFSLWL 104. GRQRGDFSLWLR
105. RQRGDFSLWLRP 106. QRGDFSLWLRPA 107. RGDFSLWLRPAR 108. GDFSLWLRPARR
109. DFSLWLRPARRA 110. FSLWLRPARRAD 111. SLWLRPARRADA 112. LWLRPARRADAG
113. WLRPARRADAGE 114. LRPARRADAGEY 115. RPARRADAGEYR 116. PARRADAGEYRA
117. ARRADAGEYRAA 118. RRADAGEYRAAV 119. RADAGEYRAAVH 120. ADAGEYRAAVHL
121. DAGEYRAAVHLR 122. AGEYRAAVHLRD 123. GEYRAAVHLRDR 124. EYRAAVHLRDRA
125. YRAAVHLRDRAL 126. RAAVHLRDRALS 127. AAVHLRDRALSC 128. AVHLRDRALSCR
129. VHLRDRALSCRL 130. HLRDRALSCRLR 131. LRDRALSCRLRL 132. RDRALSCRLRLR
133. DRALSCRLRLRL 134. RALSCRLRLRLG 135. ALSCRLRLRLGQ 136. LSCRLRLRLGQA
137. SCRLRLRLGQAS 138. CRLRLRLGQASM 139. RLRLRLGQASMT 140. LRLRLGQASMTA
141. RLRLGQASMTAS 142. LRLGQASMTASP 143. RLGQASMTASPP 144. LGQASMTASPPG
145. GQASMTASPPGS 146. QASMTASPPGSL 147. ASMTASPPGSLR 148. SMTASPPGSLRA
149. MTASPPGSLRAS 150. TASPPGSLRASD 151. ASPPGSLRASDW 152. SPPGSLRASDWV
153. PPGSLRASDWVI 154. PGSLRASDWVIL 155. GSLRASDWVILN 156. SLRASDWVILNC
157. LRASDWVILNCS 158. RASDWVILNCSF 159. ASDWVILNCSFS 160. SDWVILNCSFSR
161. DWVILNCSFSRP 162. WVILNCSFSRPD 163. VILNCSFSRPDR 164. ILNCSFSRPDRP
165. LNCSFSRPDRPA 166. NCSFSRPDRPAS 167. CSFSRPDRPASV 168. SFSRPDRPASVH
169. FSRPDRPASVHW 170. SRPDRPASVHWF 171. RPDRPASVHWFR 172. PDRPASVHWFRN
173. DRPASVHWFRNR 174. RPASVHWFRNRG 175. PASVHWFRNRGQ 176. ASVHWFRNRGQG
177. SVHWFRNRGQGR 178. VHWFRNRGQGRV 179. HWFRNRGQGRVP 180. WFRNRGQGRVPV
181. FRNRGQGRVPVR 182. RNRGQGRVPVRE 183. NRGQGRVPVRES 184. RGQGRVPVRESP
185. GQGRVPVRESPH 186. QGRVPVRESPHH 187. GRVPVRESPHHH 188. RVPVRESPHHHL
189. VPVRESPHHHLA 190. PVRESPHHHLAE 191. VRESPHHHLAES 192. RESPHHHLAESF
193. ESPHHHLAESFL 194. SPHHHLAESFLF 195. PHHHLAESFLFL 196. HHHLAESFLFLP
197. HHLAESFLFLPQ 198. HLAESFLFLPQV 199. LAESFLFLPQVS 200. AESFLFLPQVSP
201. ESFLFLPQVSPM 202. SFLFLPQVSPMD 203. FLFLPQVSPMDS 204. LFLPQVSPMDSG
205. FLPQVSPMDSGP 206. LPQVSPMDSGPW 207. PQVSPMDSGPWG 208. QVSPMDSGPWGC
209. VSPMDSGPWGCI 210. SPMDSGPWGCIL 211. PMDSGPWGCILT 212. MDSGPWGCILTY
213. DSGPWGCILTYR 214. SGPWGCILTYRD 215. GPWGCILTYRDG 216. PWGCILTYRDGF
217. WGCILTYRDGFN 218. GCILTYRDGFNV 219. CILTYRDGFNVS 220. ILTYRDGFNVSI
221. LTYRDGFNVSIM 222. TYRDGFNVSIMY 223. YRDGFNVSIMYN 224. RDGFNVSIMYNL
225. DGFNVSIMYNLT 226. GFNVSIMYNLTV 227. FNVSIMYNLTVL 228. NVSIMYNLTVLG
229. VSIMYNLTVLGL 230. SIMYNLTVLGLE 231. IMYNLTVLGLEP 232. MYNLTVLGLEPP
233. YNLTVLGLEPPT 234. NLTVLGLEPPTP 235. LTVLGLEPPTPL 236. TVLGLEPPTPLT
237. VLGLEPPTPLTV 238. LGLEPPTPLTVY 239. GLEPPTPLTVYA 240. LEPPTPLTVYAG
241. EPPTPLTVYAGA 242. PPTPLTVYAGAG 243. PTPLTVYAGAGS 244. TPLTVYAGAGSR
245. PLTVYAGAGSRV 246. LTVYAGAGSRVG 247. TVYAGAGSRVGL 248. VYAGAGSRVGLP
249. YAGAGSRVGLPC 250. AGAGSRVGLPCR 251. GAGSRVGLPCRL 252. AGSRVGLPCRLP
253. GSRVGLPCRLPA 254. SRVGLPCRLPAG 255. RVGLPCRLPAGV 256. VGLPCRLPAGVG
257. GLPCRLPAGVGT 258. LPCRLPAGVGTR 259. PCRLPAGVGTRS 260. CRLPAGVGTRSF
261. RLPAGVGTRSFL 262. LPAGVGTRSFLT 263. PAGVGTRSFLTA 264. AGVGTRSFLTAK
265. GVGTRSFLTAKW 266. VGTRSFLTAKWT 267. GTRSFLTAKWTP 268. TRSFLTAKWTPP
269. RSFLTAKWTPPG 270. SFLTAKWTPPGG 271. FLTAKWTPPGGG 272. LTAKWTPPGGGP
273. TAKWTPPGGGPD 274. AKWTPPGGGPDL 275. KWTPPGGGPDLL 276. WTPPGGGPDLLV
277. TPPGGGPDLLVT 278. PPGGGPDLLVTG 279. PGGGPDLLVTGD 280. GGGPDLLVTGDN
281. GGPDLLVTGDNG 282. GPDLLVTGDNGD 283. PDLLVTGDNGDF 284. DLLVTGDNGDFT
285. LLVTGDNGDFTL 286. LVTGDNGDFTLR 287. VTGDNGDFTLRL 288. TGDNGDFTLRLE
289. GDNGDFTLRLED 290. DNGDFTLRLEDV 291. NGDFTLRLEDVS 292. GDFTLRLEDVSQ
293. DFTLRLEDVSQA 294. FTLRLEDVSQAQ 295. TLRLEDVSQAQA 296. LRLEDVSQAQAG
297. RLEDVSQAQAGT 298. LEDVSQAQAGTY 299. EDVSQAQAGTYT 300. DVSQAQAGTYTC
301. VSQAQAGTYTCH 302. SQAQAGTYTCHI 303. QAQAGTYTCHIH 304. AQAGTYTCHIHL
305. QAGTYTCHIHLQ 306. AGTYTCHIHLQE 307. GTYTCHIHLQEQ 308. TYTCHIHLQEQQ
309. YTCHIHLQEQQL 310. TCHIHLQEQQLN 311. CHIHLQEQQLNA 312. HIHLQEQQLNAT
313. IHLQEQQLNATV 314. HLQEQQLNATVT 315. LQEQQLNATVTL 316. QEQQLNATVTLA
317. EQQLNATVTLAI 318. QQLNATVTLAII 319. QLNATVTLAIIT 320. LNATVTLAIITV
321. NATVTLAIITVT 322. ATVTLAIITVTP 323. TVTLAIITVTPK 324. VTLAIITVTPKS
325. TLAIITVTPKSF 326. LAIITVTPKSFG 327. AIITVTPKSFGS 328. IITVTPKSFGSP
329. ITVTPKSFGSPG 330. TVTPKSFGSPGS 331. VTPKSFGSPGSL 332. TPKSFGSPGSLG
333. PKSFGSPGSLGK 334. KSFGSPGSLGKL 335. SFGSPGSLGKLL 336. FGSPGSLGKLLC
337. GSPGSLGKLLCE 338. SPGSLGKLLCEV 339. PGSLGKLLCEVT 340. GSLGKLLCEVTP
341. SLGKLLCEVTPV 342. LGKLLCEVTPVS 343. GKLLCEVTPVSG 344. KLLCEVTPVSGQ
345. LLCEVTPVSGQE 346. LCEVTPVSGQER 347. CEVTPVSGQERF 348. EVTPVSGQERFV
349. VTPVSGQERFVW 350. TPVSGQERFVWS 351. PVSGQERFVWSS 352. VSGQERFVWSSL
353. SGQERFVWSSLD 354. GQERFVWSSLDT 355. QERFVWSSLDTP 356. ERFVWSSLDTPS
357. RFVWSSLDTPSQ 358. FVWSSLDTPSQR 359. VWSSLDTPSQRS 360. WSSLDTPSQRSF
361. SSLDTPSQRSFS 362. SLDTPSQRSFSG 363. LDTPSQRSFSGP 364. DTPSQRSFSGPW
365. TPSQRSFSGPWL 366. PSQRSFSGPWLE 367. SQRSFSGPWLEA 368. QRSFSGPWLEAQ
369. RSFSGPWLEAQE 370. SFSGPWLEAQEA 371. FSGPWLEAQEAQ 372. SGPWLEAQEAQL
373. GPWLEAQEAQLL 374. PWLEAQEAQLLS 375. WLEAQEAQLLSQ 376. LEAQEAQLLSQP
377. EAQEAQLLSQPW 378. AQEAQLLSQPWQ 379. QEAQLLSQPWQC 380. EAQLLSQPWQCQ
381. AQLLSQPWQCQL 382. QLLSQPWQCQLY 383. LLSQPWQCQLYQ 384. LSQPWQCQLYQG
385. SQPWQCQLYQGE 386. QPWQCQLYQGER 387. PWQCQLYQGERL 388. WQCQLYQGERLL
389. QCQLYQGERLLG 390. CQLYQGERLLGA 391. QLYQGERLLGAA 392. LYQGERLLGAAV
393. YQGERLLGAAVY 394. QGERLLGAAVYF 395. GERLLGAAVYFT 396. ERLLGAAVYFTE
397. RLLGAAVYFTEL 398. LLGAAVYFTELS 399. LGAAVYFTELSS 400. GAAVYFTELSSP
401. AAVYFTELSSPG 402. AVYFTELSSPGA 403. VYFTELSSPGAQ 404. YFTELSSPGAQR
405. FTELSSPGAQRS 406. TELSSPGAQRSG 407. ELSSPGAQRSGR 408. LSSPGAQRSGRA
409. SSPGAQRSGRAP 410. SPGAQRSGRAPG 411. PGAQRSGRAPGA 412. GAQRSGRAPGAL
413. AQRSGRAPGALP 414. QRSGRAPGALPA 415. RSGRAPGALPAG 416. SGRAPGALPAGH
417. GRAPGALPAGHL 418. RAPGALPAGHLL 419. APGALPAGHLLL 420. PGALPAGHLLLF
421. GALPAGHLLLFL 422. ALPAGHLLLFLI 423. LPAGHLLLFLIL 424. PAGHLLLFLILG
425. AGHLLLFLILGV 426. GHLLLFLILGVL 427. HLLLFLILGVLS 428. LLLFLILGVLSL
429. LLFLILGVLSLL 430. LFLILGVLSLLL 431. FLILGVLSLLLL 432. LILGVLSLLLLV
433. ILGVLSLLLLVT 434. LGVLSLLLLVTG 435. GVLSLLLLVTGA 436. VLSLLLLVTGAF
437. LSLLLLVTGAFG 438. SLLLLVTGAFGF 439. LLLLVTGAFGFH 440. LLLVTGAFGFHL
441. LLVTGAFGFHLW 442. LVTGAFGFHLWR 443. VTGAFGFHLWRR 444. TGAFGFHLWRRQ
445. GAFGFHLWRRQW 446. AFGFHLWRRQWR 447. FGFHLWRRQWRP 448. GFHLWRRQWRPR
449. FHLWRRQWRPRR 450. HLWRRQWRPRRF 451. LWRRQWRPRRFS 452. WRRQWRPRRFSA
453. RRQWRPRRFSAL 454. RQWRPRRFSALE 455. QWRPRRFSALEQ 456. WRPRRFSALEQG
457. RPRRFSALEQGI 458. PRRFSALEQGIH 459. RRFSALEQGIHP 460. RFSALEQGIHPP
461. FSALEQGIHPPQ 462. SALEQGIHPPQA 463. ALEQGIHPPQAQ 464. LEQGIHPPQAQS
465. EQGIHPPQAQSK 466. QGIHPPQAQSKI 467. GIHPPQAQSKIE 468. IHPPQAQSKIEE
469. HPPQAQSKIEEL 470. PPQAQSKIEELE 471. PQAQSKIEELEQ 472. QAQSKIEELEQE
473. AQSKIEELEQEP 474. QSKIEELEQEPE 475. SKIEELEQEPEP 476. KIEELEQEPEPE
477. IEELEQEPEPEP 478. EELEQEPEPEPE 479. ELEQEPEPEPEP 480. LEQEPEPEPEPE
481. EQEPEPEPEPEP 482. QEPEPEPEPEPE 483. EPEPEPEPEPEP 484. PEPEPEPEPEPE
485. EPEPEPEPEPEP 486. PEPEPEPEPEPE 487. EPEPEPEPEPEP 488. PEPEPEPEPEPE
489. EPEPEPEPEPEP 490. PEPEPEPEPEPE 491. EPEPEPEPEPEQ 492. PEPEPEPEPEQL

Application Notes

  • Identify high antigenicity epitopes for antibody production & vaccine development
  • Locate (auto)antigen epitopes of (auto)antibodies
  • Define the best antibody clone against the protein-of-interest
  • Perform epitope mutant analysis
  • Map B cell epitopes

Service Features

  • Small serum sample volume required (2 µl)
  • High density (simultaneously analyze hundreds of overlapping peptides)
  • High sensitivity
  • Large dynamic range
  • Suitable for high-throughput assays
  • High efficiency and accuracy
  • Affordable, quick and simple to use

Kit Components

  • RayBio® human LAG-3 protein peptide array
  • Blocking Buffer
  • Wash Buffer I
  • Wash Buffer II
  • Biotin-conjugated secondary antibody
  • Cy3 equivalent dye conjugated streptavidin
  • Array accessories (including slide incubation chamber assembly, gasket, adhesive plastic strips, etc.)

Other Materials Required

  • Distilled water
  • Small plastic boxes or containers
  • Orbital shaker or oscillating rocker
  • Pipettors, pipette tips and other common lab consumables
  • Aluminum foil
  • Laser fluorescence scanner

View Compatible Laser Scanners

Don't have a compatible scanner? RayBiotech now offers FREE scanning service for all RayBio glass slide antibody arrays! Learn More

Storage/Stability

Upon receipt, all kit components should be stored at -20 °C to -80 °C until ready to use. Stored properly, the kit will retain complete activity for up to 6 months.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Amazon Gift Card Program