Human PTEN monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11347
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms 10q23del, BZS, MGC11227, MHAM, MMAC1, PTEN1, TEP1
Accession Number AAH05821
Gene Symbols PTEN
Gene Id 5728
Applications WB, ELISA, PLA
Isotype kappa, Igg2a
Immunogen Sequence KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHK QNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI DSICSIERADNDKEYLVLTL
Gene Names PTEN
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

10q23del, BZS, MGC11227, MHAM, MMAC1, PTEN1, TEP1

Description

Mouse monoclonal antibody raised against a partial recombinant PTEN.

Source

Specificity
Human

Gene Information

Gene Accession #
BC005821

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
Proximity Ligation Analysis of protein-protein interactions between PXN and PTEN Mahlavu cells were stained with anti-PXN rabbit purified polyclonal 1:1200 and anti-PTEN mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PTEN HeLa cells were stained with anti-PDGFRB rabbit purified polyclonal 1:1200 and anti-PTEN mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged PTEN is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*