Rabbit Anti-Human BNP-32

Rabbit Anti-Human BNP-32 Antibody

$51.51  
RB-13-0001-20
+

Antigen Information

Target Species:
  • Human

Antibody Specifications

Applications:
ELISA (recommended work dilution= 1:2000)
Immunogen Sequence:
SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH
Preparation:
The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography.
Reconstitution:
Product is supplied as a powder obtained from lyophilization of purified antibody in PBS without preservatives. Reconstitute the antibody with sterile 1x PBS to a final concentration of 1 mg/ml.

Description

A polyhistidine-tag is an amino acid motif in proteins that consists of at least five histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as hexa-histidine tag, 6xHis-tag, and by the trademarked name “His-tag”. Polyhistidine-tags are often used for affinity purification of genetically modified proteins.

Specificity

This antibody binds to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA.

Storage

Store at 4°C if intended for use within one month, otherwise, store at -20°C to -80°C. The lyophilized antibody is stable for at least 18 months after the date of receipt when stored at -20°C to -80°C. After reconstitution, it can be aliquoted and stored frozen at -20°C to -80°C in a manual defrost freezer for at least 6 months without detectable loss of activity. Upon reconstitution, the antibody can also be stored for 1 month at 4°C. Please avoid multiple freeze-thaw cycles, as this will lower the activity of the antibody.

Related Products

Mouse anti-human-HA-Tag (catalog #: RB-IP-10-101 )

References

  • Maisel, A. et al., (2002). "Rapid measurement of B-type natriuretic peptide in the emergency diagnosis of heart failure". N Engl J Med 347 (3): 161–7.
  • Bhalla, V. et al., (2004). "B-type natriuretic peptide: the level and the drug--partners in the diagnosis of congestive heart failure". Congest Heart Fail 10 (1 Suppl 1): 3–27.

No posts found

Write A Review

Auto Western Service Available!

Thinking about using this antibody for western? Try our Auto Western service, which uses capillary immunoblotting to achieve ng to pg sensitivity. Just send us your samples and we will do the rest! Click here to learn more.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Auto-Western Blot Service