Recombinant Human DEFENSIN BETA 2

Purified recombinant BD-2, expressed in E. coli

$488.00
DS-01-0084
+

Source

Species:
Human
Expressed Region:
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Protein Name & Synonyms:
DEFENSIN BETA 2,

Preparation

Expression System:
E.Coli
Purity:
>98% by SDS PAGE and HPLC analysis.
Molecular Weight (kDa):
4.3kD (41 amino acid sequence/residues)

Protein Specifications

Format:
Purified recombinant protein - lyophilized
Concentration:
~0.1mg/ml after reconstitution
Endotoxin Level:
<0.1ng/ug
Preservative:
None present
Recommended Applications:
ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane)

Description

Recombinant human defensin beta-2 (BD-2), is a 4.3 kDa peptide comprised of 41 amino acid residues. BD-2, a member of the beta defensin family, is secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. This defensin is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.

Specifications

Size
20 ug

Stability & Storage

Storage/Stability
Prior to reconstitution store at +4°C.
After reconstitution store at -20°C.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for3 months from date of reconstitution.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.