TNF alpha Epitope Mapping Peptide Array

The TNF alpha Epitope Mapping Peptide Array is a semi-quantitative array displaying 222 synthesized peptides representing the full-length TNFA. It is suitable for antibody epitope mapping and detection of IgG, IgA, IgM, IgE, etc. in serum, plasma, and many other liquid sample types.

For a service quote, please fill out the Epitope Mapping Array Quote Request Form.

[Price not listed]  
PAH-TNFA-G1

Assay Format

Species Detected:
  • Human
Compatible Sample Types:
  • Ascites
  • DNA Aptamers
  • Hybridoma cell culture medium
  • Other fluids
  • Plasma
  • Purified antibodies
  • Purified protein
  • Serum
Method of Detection:
Fluorescence Laser Scanner
Quantitative/Semi-Quantitative:
  • Semi-Quantitative
Solid Support:
Glass Slide
Antibody Type:
Human IgG, mouse IgG, other isotypes (IgA, IgM, IgE, etc.) derived from most animals, upon request.

Product Specifications

Size:
1, 2, or 4 Slide Kit

Protein Information

Accession Number:
  • P01375
Gene Symbols:
  • TNFA
  • TNFSF2
Protein Name & Synonyms:
Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF) Intracellular domain 1 (ICD1) Intracellular domain 2 (ICD2) C-domain 1 C-domain 2 Tumor necrosis factor, soluble form]
Target Species:
Human
Synthesized Protein Sequence:
233 amino acids (Met1-Leu233, without N-terminal signal peptide)
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Peptide Information

Number of Peptides:
222
Peptide Length:
12-mer
Peptide Offset:
1-mer
Peptide Purity:
HPLC grade, >95% purity
Array Printing Replicate:
Triplicate

Peptide Sequence

1. MSTESMIRDVEL 2. STESMIRDVELA 3. TESMIRDVELAE 4. ESMIRDVELAEE
5. SMIRDVELAEEA 6. MIRDVELAEEAL 7. IRDVELAEEALP 8. RDVELAEEALPK
9. DVELAEEALPKK 10. VELAEEALPKKT 11. ELAEEALPKKTG 12. LAEEALPKKTGG
13. AEEALPKKTGGP 14. EEALPKKTGGPQ 15. EALPKKTGGPQG 16. ALPKKTGGPQGS
17. LPKKTGGPQGSR 18. PKKTGGPQGSRR 19. KKTGGPQGSRRC 20. KTGGPQGSRRCL
21. TGGPQGSRRCLF 22. GGPQGSRRCLFL 23. GPQGSRRCLFLS 24. PQGSRRCLFLSL
25. QGSRRCLFLSLF 26. GSRRCLFLSLFS 27. SRRCLFLSLFSF 28. RRCLFLSLFSFL
29. RCLFLSLFSFLI 30. CLFLSLFSFLIV 31. LFLSLFSFLIVA 32. FLSLFSFLIVAG
33. LSLFSFLIVAGA 34. SLFSFLIVAGAT 35. LFSFLIVAGATT 36. FSFLIVAGATTL
37. SFLIVAGATTLF 38. FLIVAGATTLFC 39. LIVAGATTLFCL 40. IVAGATTLFCLL
41. VAGATTLFCLLH 42. AGATTLFCLLHF 43. GATTLFCLLHFG 44. ATTLFCLLHFGV
45. TTLFCLLHFGVI 46. TLFCLLHFGVIG 47. LFCLLHFGVIGP 48. FCLLHFGVIGPQ
49. CLLHFGVIGPQR 50. LLHFGVIGPQRE 51. LHFGVIGPQREE 52. HFGVIGPQREEF
53. FGVIGPQREEFP 54. GVIGPQREEFPR 55. VIGPQREEFPRD 56. IGPQREEFPRDL
57. GPQREEFPRDLS 58. PQREEFPRDLSL 59. QREEFPRDLSLI 60. REEFPRDLSLIS
61. EEFPRDLSLISP 62. EFPRDLSLISPL 63. FPRDLSLISPLA 64. PRDLSLISPLAQ
65. RDLSLISPLAQA 66. DLSLISPLAQAV 67. LSLISPLAQAVR 68. SLISPLAQAVRS
69. LISPLAQAVRSS 70. ISPLAQAVRSSS 71. SPLAQAVRSSSR 72. PLAQAVRSSSRT
73. LAQAVRSSSRTP 74. AQAVRSSSRTPS 75. QAVRSSSRTPSD 76. AVRSSSRTPSDK
77. VRSSSRTPSDKP 78. RSSSRTPSDKPV 79. SSSRTPSDKPVA 80. SSRTPSDKPVAH
81. SRTPSDKPVAHV 82. RTPSDKPVAHVV 83. TPSDKPVAHVVA 84. PSDKPVAHVVAN
85. SDKPVAHVVANP 86. DKPVAHVVANPQ 87. KPVAHVVANPQA 88. PVAHVVANPQAE
89. VAHVVANPQAEG 90. AHVVANPQAEGQ 91. HVVANPQAEGQL 92. VVANPQAEGQLQ
93. VANPQAEGQLQW 94. ANPQAEGQLQWL 95. NPQAEGQLQWLN 96. PQAEGQLQWLNR
97. QAEGQLQWLNRR 98. AEGQLQWLNRRA 99. EGQLQWLNRRAN 100. GQLQWLNRRANA
101. QLQWLNRRANAL 102. LQWLNRRANALL 103. QWLNRRANALLA 104. WLNRRANALLAN
105. LNRRANALLANG 106. NRRANALLANGV 107. RRANALLANGVE 108. RANALLANGVEL
109. ANALLANGVELR 110. NALLANGVELRD 111. ALLANGVELRDN 112. LLANGVELRDNQ
113. LANGVELRDNQL 114. ANGVELRDNQLV 115. NGVELRDNQLVV 116. GVELRDNQLVVP
117. VELRDNQLVVPS 118. ELRDNQLVVPSE 119. LRDNQLVVPSEG 120. RDNQLVVPSEGL
121. DNQLVVPSEGLY 122. NQLVVPSEGLYL 123. QLVVPSEGLYLI 124. LVVPSEGLYLIY
125. VVPSEGLYLIYS 126. VPSEGLYLIYSQ 127. PSEGLYLIYSQV 128. SEGLYLIYSQVL
129. EGLYLIYSQVLF 130. GLYLIYSQVLFK 131. LYLIYSQVLFKG 132. YLIYSQVLFKGQ
133. LIYSQVLFKGQG 134. IYSQVLFKGQGC 135. YSQVLFKGQGCP 136. SQVLFKGQGCPS
137. QVLFKGQGCPST 138. VLFKGQGCPSTH 139. LFKGQGCPSTHV 140. FKGQGCPSTHVL
141. KGQGCPSTHVLL 142. GQGCPSTHVLLT 143. QGCPSTHVLLTH 144. GCPSTHVLLTHT
145. CPSTHVLLTHTI 146. PSTHVLLTHTIS 147. STHVLLTHTISR 148. THVLLTHTISRI
149. HVLLTHTISRIA 150. VLLTHTISRIAV 151. LLTHTISRIAVS 152. LTHTISRIAVSY
153. THTISRIAVSYQ 154. HTISRIAVSYQT 155. TISRIAVSYQTK 156. ISRIAVSYQTKV
157. SRIAVSYQTKVN 158. RIAVSYQTKVNL 159. IAVSYQTKVNLL 160. AVSYQTKVNLLS
161. VSYQTKVNLLSA 162. SYQTKVNLLSAI 163. YQTKVNLLSAIK 164. QTKVNLLSAIKS
165. TKVNLLSAIKSP 166. KVNLLSAIKSPC 167. VNLLSAIKSPCQ 168. NLLSAIKSPCQR
169. LLSAIKSPCQRE 170. LSAIKSPCQRET 171. SAIKSPCQRETP 172. AIKSPCQRETPE
173. IKSPCQRETPEG 174. KSPCQRETPEGA 175. SPCQRETPEGAE 176. PCQRETPEGAEA
177. CQRETPEGAEAK 178. QRETPEGAEAKP 179. RETPEGAEAKPW 180. ETPEGAEAKPWY
181. TPEGAEAKPWYE 182. PEGAEAKPWYEP 183. EGAEAKPWYEPI 184. GAEAKPWYEPIY
185. AEAKPWYEPIYL 186. EAKPWYEPIYLG 187. AKPWYEPIYLGG 188. KPWYEPIYLGGV
189. PWYEPIYLGGVF 190. WYEPIYLGGVFQ 191. YEPIYLGGVFQL 192. EPIYLGGVFQLE
193. PIYLGGVFQLEK 194. IYLGGVFQLEKG 195. YLGGVFQLEKGD 196. LGGVFQLEKGDR
197. GGVFQLEKGDRL 198. GVFQLEKGDRLS 199. VFQLEKGDRLSA 200. FQLEKGDRLSAE
201. QLEKGDRLSAEI 202. LEKGDRLSAEIN 203. EKGDRLSAEINR 204. KGDRLSAEINRP
205. GDRLSAEINRPD 206. DRLSAEINRPDY 207. RLSAEINRPDYL 208. LSAEINRPDYLD
209. SAEINRPDYLDF 210. AEINRPDYLDFA 211. EINRPDYLDFAE 212. INRPDYLDFAES
213. NRPDYLDFAESG 214. RPDYLDFAESGQ 215. PDYLDFAESGQV 216. DYLDFAESGQVY
217. YLDFAESGQVYF 218. LDFAESGQVYFG 219. DFAESGQVYFGI 220. FAESGQVYFGII
221. AESGQVYFGIIA 222. ESGQVYFGIIAL    

Application Notes

  • Identify high antigenicity epitopes for antibody production & vaccine development
  • Locate (auto)antigen epitopes of (auto)antibodies
  • Define the best antibody clone against the protein-of-interest
  • Perform epitope mutant analysis
  • Map B cell epitopes

Service Features

  • Small serum sample volume required (2 µl)
  • High density (simultaneously analyze hundreds of overlapping peptides)
  • High sensitivity
  • Large dynamic range
  • Suitable for high-throughput assays
  • High efficiency and accuracy
  • Affordable, quick and simple to use

Kit Components

  • RayBio® human TNF alpha protein peptide array
  • Blocking Buffer
  • Wash Buffer I
  • Wash Buffer II
  • Biotin-conjugated secondary antibody
  • Cy3 equivalent dye conjugated streptavidin
  • Array accessories (including slide incubation chamber assembly, gasket, adhesive plastic strips, etc.)

Other Materials Required

  • Distilled water
  • Small plastic boxes or containers
  • Orbital shaker or oscillating rocker
  • Pipettors, pipette tips and other common lab consumables
  • Aluminum foil
  • Laser fluorescence scanner

View Compatible Laser Scanners

Don't have a compatible scanner? RayBiotech now offers FREE scanning service for all RayBio glass slide antibody arrays! Learn More

Storage/Stability

Upon receipt, all kit components should be stored at -20 °C to -80 °C until ready to use. Stored properly, the kit will retain complete activity for up to 6 months.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Amazon Gift Card Program