3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10010
Human ABL2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH65912 |
| Gene Id | 27 |
| Gene Symbols | ABL2 |
| Clonality | Monoclonal |
| Immunogen Sequence | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRM AMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKS EESAAPSRERPKAKLLPRGA |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 0.5 mg/ml |
| Recommended Applications | Proximity Ligation Analysis, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (36.41 KDa). |
![]() | Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | ABL2 monoclonal antibody Western Blot analysis of ABL2 expression in Hela NE . |
![]() | Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody. Lane 1: ABL2 transfected lysate(126.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-ABL2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.