3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10016
Human ACATE2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH12573 |
| Gene Id | 23597 |
| Gene Symbols | ACATE2,ACOT9 |
| Protein Name / Synonyms | ACATE2, CGI-16, MT-ACT48 |
| Clonality | Monoclonal |
| Immunogen Sequence | MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEV RDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPP RRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDL DSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLS PEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDAT FVMVARDSENKG |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (49.06 KDa). |
![]() | ACATE2 monoclonal antibody Western Blot analysis of ACATE2 expression in MCF-7 . |
![]() | Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody. Lane 1: ACOT9 transfected lysate(24 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.